PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_009275-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 316aa    MW: 34450.3 Da    PI: 8.4905
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_009275-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.66.8e-09650344
                     SS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrw 44
                     +WT eE++ + +a++ +  +     W++Ia+ +  ++t +++k ++
  AHYPO_009275-RA  6 SWTREEEKAFENAIATHSIDesneKWDKIASVVT-TKTVEEIKQHY 50
                     6********************************9.**********9 PP

2Myb_DNA-binding42.81.2e-13133177347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
  AHYPO_009275-RA 133 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVVTRTPTQVASHAQKY 177
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.455158IPR017884SANT domain
SMARTSM007171.6E-7356IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-10660IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-5651IPR009057Homeodomain-like
CDDcd001671.06E-8650No hitNo description
PfamPF002494.3E-7651IPR001005SANT/Myb domain
PROSITE profilePS5129418.037125182IPR017930Myb domain
SuperFamilySSF466891.72E-17128183IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-18129180IPR006447Myb domain, plants
SMARTSM007171.1E-10130180IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-11131176IPR009057Homeodomain-like
CDDcd001674.89E-10133178No hitNo description
PfamPF002491.8E-11133177IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MPNLVSWTRE EEKAFENAIA THSIDESNEK WDKIASVVTT KTVEEIKQHY EFLVEDVGAI  60
EAGKVPLPNY GSDETTLSTS SNKDDDQYNP SFSKDQRGNS HQGNGYSAFC SSAMGNSSKS  120
SSKLDQERKK GIPWTEEEHR LFLLGLDKFG KGDWRSISRN FVVTRTPTQV ASHAQKYFIR  180
LNSMNRDRRR SSIHDITSVN GGGLSPNQAP ITGQQSNNTA APALGTAATG VPNKHRAQHN  240
VNMAPPGMAM YGTQMGHPVS AAAPPPPHHM TSAVGTPVML PPPGHPHHPH PHHHHPPPPY  300
AVPVAYPVVP PSIHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A5e-147831186RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010673224.11e-152PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H77e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0J8CME21e-152A0A0J8CME2_BETVU; Uncharacterized protein
STRINGVIT_17s0000g04130.t011e-119(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.16e-70MYB family protein